Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0337201_circ_g.2 |
ID in PlantcircBase | osa_circ_023425 |
Alias | Os_ciR1977 |
Organism | Oryza sativa |
Position | chr4: 15867326-15868889 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0337201 |
Parent gene annotation |
Similar to OSIGBa0137O04.8 protein. (Os04t0337201-00) |
Parent gene strand | + |
Alternative splicing | Os04g0337201_circ_g.1 Os04g0337201_circ_g.3 Os04g0337201_circ_g.4 Os04g0337201_circ_g.5 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0337201-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005383* osi_circ_014238 |
PMCS | 0.124479838 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15867362-15867337(+) 15867364-15868854(-) |
Potential amino acid sequence |
MVRENILGFVTQLPPLLRAQLGESIKTLILADYPEQWPSLLPWVTHNLESQDQIFGALYVLRIL ARKYEFKSEDERIPLYQIVEECFPRLLNILRNLVPISNPPIEVADLIKLICKIFWSSIYKKNI* (+) MDLSLSGIICFSYKWMTRKFCISA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |