Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0337201_circ_g.2 |
| ID in PlantcircBase | osa_circ_023425 |
| Alias | Os_ciR1977 |
| Organism | Oryza sativa |
| Position | chr4: 15867326-15868889 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0337201 |
| Parent gene annotation |
Similar to OSIGBa0137O04.8 protein. (Os04t0337201-00) |
| Parent gene strand | + |
| Alternative splicing | Os04g0337201_circ_g.1 Os04g0337201_circ_g.3 Os04g0337201_circ_g.4 Os04g0337201_circ_g.5 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0337201-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005383* osi_circ_014238 |
| PMCS | 0.124479838 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15867362-15867337(+) 15867364-15868854(-) |
| Potential amino acid sequence |
MVRENILGFVTQLPPLLRAQLGESIKTLILADYPEQWPSLLPWVTHNLESQDQIFGALYVLRIL ARKYEFKSEDERIPLYQIVEECFPRLLNILRNLVPISNPPIEVADLIKLICKIFWSSIYKKNI* (+) MDLSLSGIICFSYKWMTRKFCISA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |