Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0439100_circ_g.7 |
ID in PlantcircBase | osa_circ_037191 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 21345996-21347706 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0439100 |
Parent gene annotation |
Protein of unknown function DUF1336 domain containing protein. ( Os08t0439100-01) |
Parent gene strand | + |
Alternative splicing | Os08g0439100_circ_g.1 Os08g0439100_circ_g.2 Os08g0439100_circ_g.3 Os08g0439100_circ_g.4 Os08g0439100_circ_g.5 Os08g0439100_circ_igg.1 Os08g0439100_circ_g.2 Os08g0439100_circ_g.3 Os08g0439100_circ_g.4 Os08g0439100_circ_g.5 Os08g0439100_circ_g.6 Os08g0439100_circ_g.8 Os08g0439100_circ_g.9 Os08g0439100_circ_g.10 Os08g0439100_circ_g.11 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0439100-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.250147794 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21346065-21346010(+) 21346039-21347586(-) |
Potential amino acid sequence |
MLEMSPSFWDRWKRRHNENFDRSIAFALLSQVAGLREYFAANPALTSDLPSTVVKPKQSDSLII QSELEDSELNDEFYDALARGESFEDEDSDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEK SELVTNSTPVTIDSNHFHGTLRRAKSENDPNSWSEPGGEKFMIRGKTYLTDYTKPQHGN*(+) MILVGSTFLVPMLRLSVICQVSLSSYHELLSTRLTPRVWVILTFRSSKGAMEMV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |