Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0469200_circ_g.9 |
| ID in PlantcircBase | osa_circ_014628 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 15852861-15855208 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0469200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0469200-01);Similar to pre dicted protein. (Os02t0469200-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0469200_circ_g.5 Os02g0469200_circ_g.6 Os02g0469200_circ_g.7 Os02g0469200_circ_g.8 Os02g0469200_circ_g.10 Os02g0469200_circ_g.11 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0469200-02:4 Os02t0469200-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.108113277 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15852969-15852974(+) 15852889-15854526(-) |
| Potential amino acid sequence |
MVVVVQSEVDSWESHLQCNGRSILWDLRRPVKAAIAATAEYVSGLLPSHLAYSPAHETATEDWT WSVGCNPLSITSKGWQLSEFQRDVIARNYIITAVEESIQIINSAIQQLITERTSERGFKLFKAQ ERVLVEKYNSVVSLWRREDTQITGQHWRFQYSGSYIVNPYYWINIIKPNLFQTWL*(+) MLTCDLSVLPSPQANNRIILFNQHSLLSLEKFKASFTCPFCNQLLNC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |