Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0577800_circ_g.3 |
| ID in PlantcircBase | osa_circ_008175 |
| Alias | Os_ciR6924 |
| Organism | Oryza sativa |
| Position | chr10: 23035994-23036745 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os10g0577800 |
| Parent gene annotation |
Poly(ADP-ribose) polymerase, catalytic region domain containing protein. (Os10t0577800-01);Similar to Poly polymerase catalytic domain containing protein, expressed. (Os10t0577800-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0577800_circ_g.1 Os10g0577800_circ_g.2 Os10g0577800_circ_g.4 Os10g0577800_circ_g.5 Os10g0577800_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0577800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.232882458 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23036342-23036017(+) 23036367-23036694(-) |
| Potential amino acid sequence |
MLEKPEGSCPVIHYQANQSSRSVMKPLINCDNLLRWQENLILESHYC*(+) MNLQASPALGGHYEAPMLGDKVERAPSTPWMPFSMLFAAISTKVSAENMDMVNSCYEEFKSKKI SRVDLVKKLRHIVGDRMLISTIMRLQDKILLPPKKIVTIYQRFHH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |