Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0577800_circ_g.6 |
ID in PlantcircBase | osa_circ_008177 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 23036657-23037102 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0577800 |
Parent gene annotation |
Poly(ADP-ribose) polymerase, catalytic region domain containing protein. (Os10t0577800-01);Similar to Poly polymerase catalytic domain containing protein, expressed. (Os10t0577800-02) |
Parent gene strand | - |
Alternative splicing | Os10g0577800_circ_g.1 Os10g0577800_circ_g.2 Os10g0577800_circ_g.3 Os10g0577800_circ_g.4 Os10g0577800_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0577800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008750 |
PMCS | 0.226077915 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23036944-23036863(+) 23037064-23037090(-) |
Potential amino acid sequence |
MLRVFNVIYTTIEILVTRPMLLRSMVNYFYVPHYNTAQHHMDNAIFINIRVIHTVIHYQANQSS RSVMKPLINCDNLLRWQENL*(+) MMLCRVVMGNVEIVHHGSKQHRPSNEYFDSGVDDIKNPQHYIVWDMNVNSHIYSEFVVTIKLPS RVKDSPATEEDCHNLSEVSSLILSSGSPDSVSQCELL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |