Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0684500_circ_g.6 |
| ID in PlantcircBase | osa_circ_026034 |
| Alias | Os04circ18480 |
| Organism | Oryza sativa |
| Position | chr4: 34965141-34966553 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os04g0684500 |
| Parent gene annotation |
Pentatricopeptide repeat domain containing protein. (Os04t068450 0-01);Hypothetical conserved gene. (Os04t0684500-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0684500_circ_g.2 Os04g0684500_circ_g.3 Os04g0684500_circ_g.4 Os04g0684500_circ_g.5 Os04g0684500_circ_g.7 Os04g0684500_circ_g.8 |
| Support reads | 4/3 |
| Tissues | leaf/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0684500-01:3 Os04t0684500-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005857* osi_circ_015027 |
| PMCS | 0.399216814 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34966520-34966047(+) 34965224-34966515(-) 34965220-34966511(-) |
| Potential amino acid sequence |
MRVAVHINGWHRWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEM VDVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMKLAGLKPDEASYHCLVTSLLSRATVMEGS TYTGIISVCREMSENDLTVDLRTAVHWSRWLHKIERTGGALTEALQRIFPPDWNSLEFLGEPSS SISMGESDDYSDSDFSGDEDEDHNIDDS*(+) MDVRRDTIFFHLLHQVLCFPNITSPSPSVPAIDMYSYTHN*(-) MLGGTPSSFICFIKSSASQTSPLRAHLCQPLICTATRITE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |