Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0684500_circ_g.6 |
ID in PlantcircBase | osa_circ_026034 |
Alias | Os04circ18480 |
Organism | Oryza sativa |
Position | chr4: 34965141-34966553 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os04g0684500 |
Parent gene annotation |
Pentatricopeptide repeat domain containing protein. (Os04t068450 0-01);Hypothetical conserved gene. (Os04t0684500-02) |
Parent gene strand | + |
Alternative splicing | Os04g0684500_circ_g.2 Os04g0684500_circ_g.3 Os04g0684500_circ_g.4 Os04g0684500_circ_g.5 Os04g0684500_circ_g.7 Os04g0684500_circ_g.8 |
Support reads | 4/3 |
Tissues | leaf/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0684500-01:3 Os04t0684500-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005857* osi_circ_015027 |
PMCS | 0.399216814 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34966520-34966047(+) 34965224-34966515(-) 34965220-34966511(-) |
Potential amino acid sequence |
MRVAVHINGWHRWARRGDVWEAEDLMKQMKEDGVPPNIHTYTSYINACCKAGDMQRAEKVIEEM VDVGLKPNVKTYTTLIKGWARVSLPDRALKCFEEMKLAGLKPDEASYHCLVTSLLSRATVMEGS TYTGIISVCREMSENDLTVDLRTAVHWSRWLHKIERTGGALTEALQRIFPPDWNSLEFLGEPSS SISMGESDDYSDSDFSGDEDEDHNIDDS*(+) MDVRRDTIFFHLLHQVLCFPNITSPSPSVPAIDMYSYTHN*(-) MLGGTPSSFICFIKSSASQTSPLRAHLCQPLICTATRITE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |