Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025128_circ_g.5 |
ID in PlantcircBase | zma_circ_010280 |
Alias | zma_circ_0000019, GRMZM2G126545_C2 |
Organism | Zea mays |
Position | chr10: 105645703-105646366 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d025128 |
Parent gene annotation |
methyl binding domain113 |
Parent gene strand | - |
Alternative splicing | Zm00001d025128_circ_g.2 Zm00001d025128_circ_g.3 Zm00001d025128_circ_g.4 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d025128_T012:3 Zm00001d025128_T011:3 Zm00001d025128_T003:3 Zm00001d025128_T017:3 Zm00001d025128_T009:3 Zm00001d025128_T001:3 Zm00001d025128_T006:3 Zm00001d025128_T007:3 Zm00001d025128_T016:3 Zm00001d025128_T015:3 Zm00001d025128_T004:3 Zm00001d025128_T014:3 Zm00001d025128_T013:3 Zm00001d025128_T010:3 Zm00001d025128_T008:3 Zm00001d025128_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.166037158 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
105646196-105646360(-) |
Potential amino acid sequence |
MEVCQEDNGSIYKYYTSPMSGYMFTSKMETLHYLFSGVEERMLELQASAEDNELHESHTWLPRG WVIEVRAGGKKMDKMYKGE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |