Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0316900_circ_g.5 |
ID in PlantcircBase | osa_circ_014453 |
Alias | Os_ciR7655 |
Organism | Oryza sativa |
Position | chr2: 12579083-12584534 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os02g0316900 |
Parent gene annotation |
B-block binding subunit of TFIIIC domain containing protein. (Os 02t0316900-01);B-block binding subunit of TFIIIC domain containi ng protein. (Os02t0316900-02) |
Parent gene strand | + |
Alternative splicing | Os02g0316900_circ_g.1 Os02g0316900_circ_g.2 Os02g0316900_circ_g.3 Os02g0316900_circ_g.4 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0316900-01:3 Os02t0316900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003861* |
PMCS | 0.324817219 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12584475-12579087(+) 12579172-12584457(-) 12579117-12584402(-) |
Potential amino acid sequence |
MKVRRSLPHDCKGVESLFAAET*(+) MSSCQIFSDFPFQLSLTIYATPPSVQNYVSAAKRDSTPLQSCGKLRLTFIHETLL*(-) MQLHHQYKTMFLLQREIQLLCNRVANFVSLSFMRRCCNSRCWSVVITLTELHERG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |