Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0316900_circ_g.5 |
| ID in PlantcircBase | osa_circ_014453 |
| Alias | Os_ciR7655 |
| Organism | Oryza sativa |
| Position | chr2: 12579083-12584534 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0316900 |
| Parent gene annotation |
B-block binding subunit of TFIIIC domain containing protein. (Os 02t0316900-01);B-block binding subunit of TFIIIC domain containi ng protein. (Os02t0316900-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0316900_circ_g.1 Os02g0316900_circ_g.2 Os02g0316900_circ_g.3 Os02g0316900_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0316900-01:3 Os02t0316900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003861* |
| PMCS | 0.324817219 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12584475-12579087(+) 12579172-12584457(-) 12579117-12584402(-) |
| Potential amino acid sequence |
MKVRRSLPHDCKGVESLFAAET*(+) MSSCQIFSDFPFQLSLTIYATPPSVQNYVSAAKRDSTPLQSCGKLRLTFIHETLL*(-) MQLHHQYKTMFLLQREIQLLCNRVANFVSLSFMRRCCNSRCWSVVITLTELHERG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |