Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038849_circ_g.4 |
ID in PlantcircBase | zma_circ_009164 |
Alias | Zm06circ00101, zma_circ_0002307, GRMZM2G016503_C2 |
Organism | Zea mays |
Position | chr6: 165825412-165831692 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d038849 |
Parent gene annotation |
alpha/beta-Hydrolases superfamily protein |
Parent gene strand | + |
Alternative splicing | Zm00001d038849_circ_g.1 Zm00001d038849_circ_g.2 Zm00001d038849_circ_g.3 Zm00001d038849_circ_g.5 Zm00001d038849_circ_g.6 Zm00001d038849_circ_g.7 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038849_T002:4 Zm00001d038849_T003:3 Zm00001d038849_T001:3 Zm00001d038849_T004:3 Zm00001d038849_T005:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127165847 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
165831618-165825614(+) 165825451-165831607(-) |
Potential amino acid sequence |
MEGRLGKNFMRRINEDGYIDVKNKKVICEQRVIIPNGHGEKLVGLLHRTSSKNLVILCHGFQAT KASPYHPWIFFFFLHLGTLDWILSFALWL*(+) MPVWNYNSLFANNFFILHINVSIFVYSPHEILPKASLHTSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |