Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0294200_circ_g.3 |
| ID in PlantcircBase | osa_circ_019333 |
| Alias | Os03circ12067 |
| Organism | Oryza sativa |
| Position | chr3: 10264221-10264603 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os03g0294200 |
| Parent gene annotation |
Similar to Fructose-6-phosphate-2-kinase/fructose-2, 6-bisphosph atase. (Os03t0294200-01);Similar to F2KP (FRUCTOSE-2,6-BISPHOSPH ATASE); fructose-2,6-bisphosphate 2-phosphatase. (Os03t0294200-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os03g0294200_circ_g.4 Os03g0294200_circ_g.5 Os03g0294200_circ_g.6 Os03g0294200_circ_g.7 |
| Support reads | 3/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0294200-02:2 Os03t0294200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137954591 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10264566-10264600(+) |
| Potential amino acid sequence |
MEDMLSWMQEGGQTADFFRGDNKEGVEARNEVAALAMEDMLSWMQEGGQTADFFRGDNKEGVEA RNEVAALAMEDMLSWMQEGGQTADFFRGDNKEGVEARNEVAALAMEDMLSWMQEGGQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |