Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0786900_circ_g.1 |
| ID in PlantcircBase | osa_circ_022179 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 32680856-32682976 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0786900 |
| Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os03t 0786900-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0786900_circ_g.2 Os03g0786900_circ_g.3 Os03g0786900_circ_g.4 Os03g0786900_circ_g.5 Os03g0786900_circ_g.6 Os03g0786900_circ_g.7 Os03g0786900_circ_g.8 Os03g0786900_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0786900-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141816113 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32680910-32680906(+) |
| Potential amino acid sequence |
MRTLSFSEHETFDHPVACLLVVSSKDNEPISKFVDLFNTNQLPSLLNEGIMDPQILKHYLILHD QQDGPQEIAMNILAEMKSTLGLNDCKLLCINSSTEADGADAENSWLPYKSHGLHNQDGACWLNT DDLNEIKDFMQDLASNHIIPYMEQKIRVLNQQVATTRKGFRNQIKNLWWRKRDDVPEAANGPMY TFTSIESQIRVLGDYAFMLRDYELALSNYRLLSTDYKLDKAWKRFAGVQEMSGLCYFMLDQSRK DAEYCLDSAFSTYLSLKLNCALCGLRNSTEL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |