Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0254800_circ_g.12 |
| ID in PlantcircBase | osa_circ_018922 |
| Alias | Os_ciR9185 |
| Organism | Oryza sativa |
| Position | chr3: 8180635-8181019 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0254800 |
| Parent gene annotation |
Similar to Chorismate synthase 1, chloroplast precursor (EC 4.2. 3.5) (5- enolpyruvylshikimate-3-phosphate phospholyase 1). (Os03 t0254800-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0254800_circ_g.1 Os03g0254800_circ_g.2 Os03g0254800_circ_g.3 Os03g0254800_circ_g.4 Os03g0254800_circ_g.5 Os03g0254800_circ_g.6 Os03g0254800_circ_g.7 Os03g0254800_circ_g.8 Os03g0254800_circ_g.9 Os03g0254800_circ_g.10 Os03g0254800_circ_g.11 |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0254800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.200002208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8180956-8180647(+) 8180893-8180637(-) |
| Potential amino acid sequence |
MRLSISCNLEVVPKYICRRLHLFMCP*(+) MQVELDRRRPGQSRITTPRKETDTCKILSGTHEEVKASANVFGNYFQVATYGESHGGGVGCVIS GCPPRIPLTEADMQVELDRRRPGQSRITTPRKETDTCKILSGTHEEVKASANVFGNYFQVATYG ESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETDTCKILSGTHEEVKASAN VFGNYFQVATYGESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETDTCKIL SGTHE(-) |
| Sponge-miRNAs | osa-miR156j-5p osa-miR156k |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |