Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0527400_circ_g.6 |
ID in PlantcircBase | osa_circ_024635 |
Alias | Os_ciR3920 |
Organism | Oryza sativa |
Position | chr4: 26366681-26367406 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os04g0527400 |
Parent gene annotation |
BRO1 domain containing protein. (Os04t0527400-01);BRO1 domain co ntaining protein. (Os04t0527400-02);BRO1 domain containing prote in. (Os04t0527400-03);BRO1 domain containing protein. (Os04t0527 400-04) |
Parent gene strand | + |
Alternative splicing | Os04g0527400_circ_g.2 Os04g0527400_circ_g.3 Os04g0527400_circ_g.4 Os04g0527400_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0527400-02:3 Os04t0527400-01:3 Os04t0527400-04:3 Os04t0527400-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014584 |
PMCS | 0.185145753 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26366691-26366729(+) 26367096-26366709(+) |
Potential amino acid sequence |
MQLGLAIDSPKATLAVKRRLACEMVKYWHQIQESIPEIPVSDGWGKKHLLFVKWKYVEAKAAAY YFHGLILDEGNTEKSHGMAVAALQASEEFLKESKRASEAFHATPPTSRSPTPFGTAKYMLDKIP KDASSKVKINQDLYTQERESTCNLVWQLIAQRPL*(+) MQLLQHQGAPLLSEQLSTCLTRFQKMLQARSRSIRTCIRKRGSRHATWSGN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |