Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0527400_circ_g.6 |
| ID in PlantcircBase | osa_circ_024635 |
| Alias | Os_ciR3920 |
| Organism | Oryza sativa |
| Position | chr4: 26366681-26367406 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0527400 |
| Parent gene annotation |
BRO1 domain containing protein. (Os04t0527400-01);BRO1 domain co ntaining protein. (Os04t0527400-02);BRO1 domain containing prote in. (Os04t0527400-03);BRO1 domain containing protein. (Os04t0527 400-04) |
| Parent gene strand | + |
| Alternative splicing | Os04g0527400_circ_g.2 Os04g0527400_circ_g.3 Os04g0527400_circ_g.4 Os04g0527400_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0527400-02:3 Os04t0527400-01:3 Os04t0527400-04:3 Os04t0527400-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014584 |
| PMCS | 0.185145753 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26366691-26366729(+) 26367096-26366709(+) |
| Potential amino acid sequence |
MQLGLAIDSPKATLAVKRRLACEMVKYWHQIQESIPEIPVSDGWGKKHLLFVKWKYVEAKAAAY YFHGLILDEGNTEKSHGMAVAALQASEEFLKESKRASEAFHATPPTSRSPTPFGTAKYMLDKIP KDASSKVKINQDLYTQERESTCNLVWQLIAQRPL*(+) MQLLQHQGAPLLSEQLSTCLTRFQKMLQARSRSIRTCIRKRGSRHATWSGN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |