Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0737000_circ_g.26 |
| ID in PlantcircBase | osa_circ_021735 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30207381-30208243 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0737000 |
| Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 03t0737000-01);Hypothetical gene. (Os03t0737000-02);Similar to C BS domain containing protein, expressed. (Os03t0737000-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0737000_circ_g.23 Os03g0737000_circ_g.24 Os03g0737000_circ_g.25 Os03g0737000_circ_g.27 Os03g0737000_circ_g.28 Os03g0737000_circ_g.29 Os03g0737000_circ_g.30 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0737000-03:3 Os03t0737000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013603 |
| PMCS | 0.276786819 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30208244-30208090(-) |
| Potential amino acid sequence |
MQRAIQAIGSHGSLLKSAVLRHISAPKPSILPAVYSRSMSVSSAQIEESGFETATVADILKSKG KSADGSWLWCTTDDSVYDAVKSMTQHNVGALVVVKPGQDKSIAGIVTERDYLRKIIVQGRSSKS TKVGDIMTEENATGNSSYRVTWQSPQVCCSATHQCSKTIYFTCCIFTLHVSFICSNRGEWI*(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |