Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0737000_circ_g.30 |
ID in PlantcircBase | osa_circ_021739 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30207985-30208243 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0737000 |
Parent gene annotation |
Cystathionine beta-synthase, core domain containing protein. (Os 03t0737000-01);Hypothetical gene. (Os03t0737000-02);Similar to C BS domain containing protein, expressed. (Os03t0737000-03) |
Parent gene strand | - |
Alternative splicing | Os03g0737000_circ_g.23 Os03g0737000_circ_g.24 Os03g0737000_circ_g.25 Os03g0737000_circ_g.26 Os03g0737000_circ_g.27 Os03g0737000_circ_g.28 Os03g0737000_circ_g.29 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0737000-01:1 Os03t0737000-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.314762066 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30208244-30208090(-) 30208042-30208090(-) |
Potential amino acid sequence |
MQRAIQAIGSHGSLLKSAVLRHISAPKPSILPAVYSRSMSVSSAQIEESGFETATVADILKSKG KSADGSWLWCTTDDSVYDAVKSNATGNSSYRVTWQSPQVCCSATHQCSKTIYFTCCIFTLHVSF ICSNRGEWI*(-) MDLGSGALLMTLSMMLSNLMQRAIQAIGSHGSLLKSAVLRHISAPKPSILPAVYSRSMSVSSAQ IEESGFETATVADILKSKGKSADGSWLWCTTDDSVYDAVKSNATGNSSYRVTWQSPQVCCSATH QCSKTIYFTCCIFTLHVSFICSNRGEWI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |