Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0592500_circ_g.6 |
ID in PlantcircBase | osa_circ_029178 |
Alias | Os_ciR3995 |
Organism | Oryza sativa |
Position | chr5: 29522020-29524301 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os05g0592500 |
Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os05t059250 0-01) |
Parent gene strand | + |
Alternative splicing | Os05g0592500_circ_g.3 Os05g0592500_circ_g.4 Os05g0592500_circ_g.5 Os05g0592500_circ_g.7 Os05g0592500_circ_g.8 Os05g0592500_circ_g.9 Os05g0592500_circ_g.10 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0592500-01:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.112457165 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29524266-29522245(+) 29522391-29522085(+) |
Potential amino acid sequence |
MFAAPSWKTPLEACETRLKWSNCFVTSWKKYQKILKRNVLLSSHSLLVRYLPVKLTSS*(+) MDLLFSFVRPGHPHSTLLAGYFSKVVICLMLRKTSPLMNYVQEHPDIVVHLVDLIGTTSIMEVL IRLIGADETIYSNYADTLQWLENTDVLEMIVDKFSSSDSPEVHANAAEILSAVTRCAPPALAAK ICSPSFVGRLFRHALQESRPKSVLVHSLSVCISLLDPKRLASASYQAFRSNLSHGTLVTASPET VDGMLESLGDLLKLLDISSAENVLPTTYGCLQPPLGKHRLKLARQGSSGAIASLHRGRSTRRF* (+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |