Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0592500_circ_g.5 |
ID in PlantcircBase | osa_circ_029177 |
Alias | Os05circ20545/Os_ciR182, |
Organism | Oryza sativa |
Position | chr5: 29522020-29522678 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ, CIRI-long |
Parent gene | Os05g0592500 |
Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os05t059250 0-01) |
Parent gene strand | + |
Alternative splicing | Os05g0592500_circ_g.3 Os05g0592500_circ_g.4 Os05g0592500_circ_g.6 Os05g0592500_circ_g.7 Os05g0592500_circ_g.8 Os05g0592500_circ_g.9 Os05g0592500_circ_g.10 |
Support reads | 10/267/43/45 |
Tissues | leaf and panicle/root/root/shoot, root, seed, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0592500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015858 |
PMCS | 0.3544261 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29522634-29522245(+) 29522391-29522085(+) 29522672-29522085(+) |
Potential amino acid sequence |
MFDAEKDFPSNELCPACETRLKWSNCFVTSWKKYQKILKRNVLLSSHSLLVRYLPVKLTSS*(+ ) MDLLFSFVRPGHPHSTLLAGYFSKVVICLMLRKTSPLMNYVQLARQGSSGAIASLHRGRSTRRF *(+) MSSLRDKAQVEQLLRYIVEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDEELMDLLFS FVRPGHPHSTLLAGYFSKVVICLMLRKTSPLMNYVQLARQGSSGAIASLHRGRSTRRF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017; this study |