Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0592500_circ_g.5 |
| ID in PlantcircBase | osa_circ_029177 |
| Alias | Os05circ20545/Os_ciR182, |
| Organism | Oryza sativa |
| Position | chr5: 29522020-29522678 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ, CIRI-long |
| Parent gene | Os05g0592500 |
| Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os05t059250 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0592500_circ_g.3 Os05g0592500_circ_g.4 Os05g0592500_circ_g.6 Os05g0592500_circ_g.7 Os05g0592500_circ_g.8 Os05g0592500_circ_g.9 Os05g0592500_circ_g.10 |
| Support reads | 10/267/43/45 |
| Tissues | leaf and panicle/root/root/shoot, root, seed, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0592500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015858 |
| PMCS | 0.3544261 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29522634-29522245(+) 29522391-29522085(+) 29522672-29522085(+) |
| Potential amino acid sequence |
MFDAEKDFPSNELCPACETRLKWSNCFVTSWKKYQKILKRNVLLSSHSLLVRYLPVKLTSS*(+ ) MDLLFSFVRPGHPHSTLLAGYFSKVVICLMLRKTSPLMNYVQLARQGSSGAIASLHRGRSTRRF *(+) MSSLRDKAQVEQLLRYIVEEVPEDSEKKRSFKFPFIACEIFTCEIDIILRTLVEDEELMDLLFS FVRPGHPHSTLLAGYFSKVVICLMLRKTSPLMNYVQLARQGSSGAIASLHRGRSTRRF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017; this study |