Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0592500_circ_g.9 |
ID in PlantcircBase | osa_circ_029181 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29524204-29525874 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0592500 |
Parent gene annotation |
SIT4 phosphatase-associated protein family protein. (Os05t059250 0-01) |
Parent gene strand | + |
Alternative splicing | Os05g0592500_circ_g.3 Os05g0592500_circ_g.4 Os05g0592500_circ_g.5 Os05g0592500_circ_g.6 Os05g0592500_circ_g.7 Os05g0592500_circ_g.8 Os05g0592500_circ_g.10 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0592500-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.128929379 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29525658-29524212(+) 29524773-29525627(-) |
Potential amino acid sequence |
MYSNDDIEEAQVIERDDEVIC*(+) MERFTADWLISSCSAVSLPIVSKTEMNSTIFKRCFPRGGCKHPYVVGKTFSAEEISNNFSKSPH HLVQLLVPLQCHHCCTFHTGMPGSGY*(-) |
Sponge-miRNAs | osa-miR5152-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |