Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0527100_circ_g.2 |
ID in PlantcircBase | osa_circ_039927 |
Alias | Os_ciR1338 |
Organism | Oryza sativa |
Position | chr9: 20620489-20621332 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, find_circ |
Parent gene | Os09g0527100 |
Parent gene annotation |
Similar to RNA-binding protein. (Os09t0527100-01);Hypothetical c onserved gene. (Os09t0527100-02) |
Parent gene strand | + |
Alternative splicing | Os09g0527100_circ_g.2 Os09g0527100_circ_g.3 Os09g0527100_circ_g.4 Os09g0527100_circ_ag.1 Os09g0527100_circ_ag.3 Os09g0527100_circ_ag.4 Os09g0527100_circ_ag.5 Os09g0527100_circ_ag.6 Os09g0527100_circ_ag.7 |
Support reads | 12/55 |
Tissues | root/root, seed, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0527100-02:3 Os09t0527100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018669 osi_circ_018670 |
PMCS | 0.652529262 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20621165-20620589(+) 20620516-20621160(-) |
Potential amino acid sequence |
MWKVYNLLCFVDFATPSEARAALETLQGYKFDEHDHESSNLRTQFSLTPRRRSIGGPCVRN*(+ ) MVMFIKLIALQSLQSSTSFRRSCKINKTQEIIYLPHI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |