Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0527100_circ_g.3 |
ID in PlantcircBase | osa_circ_039924 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 20619376-20625432 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0527100 |
Parent gene annotation |
Similar to RNA-binding protein. (Os09t0527100-01);Hypothetical c onserved gene. (Os09t0527100-02) |
Parent gene strand | + |
Alternative splicing | Os09g0527100_circ_g.2 Os09g0527100_circ_g.4 Os09g0527100_circ_ag.1 Os09g0527100_circ_g.2 Os09g0527100_circ_ag.3 Os09g0527100_circ_ag.4 Os09g0527100_circ_ag.5 Os09g0527100_circ_ag.6 Os09g0527100_circ_ag.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0527100-02:9 Os09t0527100-01:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.088127988 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20625364-20619410(+) 20619440-20625393(-) |
Potential amino acid sequence |
MEHVSLRFSFRAKGNCSSELCEFDMPSGTGKWPLP*(+) MAIEGAHSFMEEAISLFQKAYQIHIAPKSNSPLP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |