Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0784400_circ_g.1 |
| ID in PlantcircBase | osa_circ_022133 |
| Alias | Os_ciR8894 |
| Organism | Oryza sativa |
| Position | chr3: 32555160-32556354 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0784400 |
| Parent gene annotation |
Protein of unknown function DUF1692 domain containing protein. ( Os03t0784400-01);Similar to predicted protein. (Os03t0784400-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0784400_circ_g.2 Os03g0784400_circ_g.3 Os03g0784400_circ_g.4 Os03g0784400_circ_g.5 Os03g0784400_circ_g.6 Os03g0784400_circ_g.7 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0784400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013722 |
| PMCS | 0.14500636 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32555168-32556171(+) 32555213-32555416(-) |
| Potential amino acid sequence |
MGRIPSLKNFNAFPHAEDHLLKKTYSGAIVTIFGLIIMVTLFAHELKFYLTTYTVHQMSVDLKR GETLPIHINMSFPSLPCEVLSVDAIDMSGKHEVDLHTNIWKLKNGEDTVSEKFQCLPPCGRPLT KEDLLWCYRHDFRTNYNGYVICARAQILSYHLYCSSDVCRSETRRNSANSYKYVISLSTM*(+) MGEGIEIFQRRYPPHFSASKYLYASPLHACQTCQLHPHSRLHMVEREMTYLYELAEFLLVSDLQ TSDEQYRW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |