Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0784400_circ_g.6 |
ID in PlantcircBase | osa_circ_022138 |
Alias | Os03circ28554 |
Organism | Oryza sativa |
Position | chr3: 32557681-32558951 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
Parent gene | Os03g0784400 |
Parent gene annotation |
Protein of unknown function DUF1692 domain containing protein. ( Os03t0784400-01);Similar to predicted protein. (Os03t0784400-02) |
Parent gene strand | + |
Alternative splicing | Os03g0784400_circ_g.1 Os03g0784400_circ_g.2 Os03g0784400_circ_g.3 Os03g0784400_circ_g.4 Os03g0784400_circ_g.5 Os03g0784400_circ_g.7 |
Support reads | 2/9 |
Tissues | leaf/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0784400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005157* osi_circ_013724 |
PMCS | 0.478678807 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32558849-32557684(+) 32557750-32557761(+) |
Potential amino acid sequence |
MIYPLVQNILEFIIHWMRLQGYSMIQVGPSNTISRS*(+) MVKSVKQAMENGEGCRVYGVLDVQRVAGNFHISVHGLNIFVAEKIFDGSSHVNVSHIIHDLSFG PKYPGIHNPLDETTRILHDTSGTFKYYIKIMTMSMKMNKRSKSTPLMKMQKKWLRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |