Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0596900_circ_g.12 |
| ID in PlantcircBase | osa_circ_020598 |
| Alias | Os_ciR8661 |
| Organism | Oryza sativa |
| Position | chr3: 22222839-22223794 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0596900 |
| Parent gene annotation |
GTP-binding signal recognition particle SRP54, G-domain containi ng protein. (Os03t0596900-01);Hypothetical conserved gene. (Os03 t0596900-02);Hypothetical conserved gene. (Os03t0596900-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0596900_circ_g.1 Os03g0596900_circ_g.2 Os03g0596900_circ_g.3 Os03g0596900_circ_g.4 Os03g0596900_circ_g.5 Os03g0596900_circ_g.6 Os03g0596900_circ_g.7 Os03g0596900_circ_g.8 Os03g0596900_circ_g.9 Os03g0596900_circ_g.10 Os03g0596900_circ_g.11 Os03g0596900_circ_g.13 Os03g0596900_circ_g.14 Os03g0596900_circ_g.15 Os03g0596900_circ_g.16 Os03g0596900_circ_g.17 Os03g0596900_circ_g.18 Os03g0596900_circ_g.19 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0596900-01:3 Os03t0596900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223204725 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22223745-22222841(-) 22222913-22223110(-) |
| Potential amino acid sequence |
MFFLAGKARFDFKGHILQFSGFVWHESDEKQRAKAKEKLDKCVKDMLLELCWILAIPTPKANIR KWRTEYQGKNLLILSFFTMFFLAGKARFDFKGHILQFSGFVWHESDEKQRAKAKEKLDKCVKDM LLELCWILAIPTPKANIRKWRTEYQGKNLLILSFFTMFFLAGKARFDFKGHILQFSGFVWHESD EKQRAKAKEKLDKCVKDMLLELCWILAIPTPKANIRKWRTEYQGKNLLILSFFTMFFLAGKARF DFKGHILQFSGFVWHESDEKQRAKAKEKLDKCVKDMLLELCWILAIPTPKANIRK(-) MCERHVVGTLLDPCYSDSKSKHQKVAHRISRKKPADLKFLHNVLFGRKGKV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |