Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0199300_circ_g.7 |
| ID in PlantcircBase | osa_circ_036287 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 5748422-5748933 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0199300 |
| Parent gene annotation |
Similar to YyaF/YCHF TRANSFAC/OBG family small GTpase plus RNA b inding domain TGS (Fragment). (Os08t0199300-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0199300_circ_g.1 Os08g0199300_circ_g.2 Os08g0199300_circ_g.3 Os08g0199300_circ_g.4 Os08g0199300_circ_g.5 Os08g0199300_circ_g.6 Os08g0199300_circ_g.8 Os08g0199300_circ_g.9 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0199300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007588* osi_circ_018296 |
| PMCS | 0.169271077 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5748644-5748502(+) |
| Potential amino acid sequence |
MKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLEHLKTKKL LILMIQWILLEIWKLLVKS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |