Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0481100_circ_g.7 |
ID in PlantcircBase | osa_circ_028258 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 23660483-23661589 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0481100 |
Parent gene annotation |
Similar to cDNA clone:J013034D11, full insert sequence. (Os05t04 81100-01);Similar to predicted protein. (Os05t0481100-02);Simila r to cDNA clone:J013034D11, full insert sequence. (Os05t0481100- 03);Similar to cDNA clone:J013034D11, full insert sequence. (Os0 5t0481100-04);Similar to cDNA clone:J013034D11, full insert sequ ence. (Os05t0481100-05);Similar to cDNA clone:J013021N20, full i nsert sequence. (Os05t0481100-06) |
Parent gene strand | + |
Alternative splicing | Os05g0481100_circ_g.8 Os05g0481100_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0481100-06:4 Os05t0481100-01:4 Os05t0481100-05:3 Os05t0481100-04:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.198107197 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23661024-23660596(+) |
Potential amino acid sequence |
MCLLEPAYSELCNTLFCCQYPCSTSISSFYFSIAGKSKPPLGFGLRLHIALGASKGILYLHTDA DPPIFHRDVKASNILLDSKYVAKVADFGLSRLAPVPDVEGALPAHVSTVVKGTPGYLDPEYFLT HKLTDKSDVYSLGVVFLELLTGMKPIEHGKNIVRECRDFLSKLMGSDASHMKKWLLLQIILICQ LKLVKEVME*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |