Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0481100_circ_g.9 |
| ID in PlantcircBase | osa_circ_028259 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 23661126-23661589 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0481100 |
| Parent gene annotation |
Similar to cDNA clone:J013034D11, full insert sequence. (Os05t04 81100-01);Similar to predicted protein. (Os05t0481100-02);Simila r to cDNA clone:J013034D11, full insert sequence. (Os05t0481100- 03);Similar to cDNA clone:J013034D11, full insert sequence. (Os0 5t0481100-04);Similar to cDNA clone:J013034D11, full insert sequ ence. (Os05t0481100-05);Similar to cDNA clone:J013021N20, full i nsert sequence. (Os05t0481100-06) |
| Parent gene strand | + |
| Alternative splicing | Os05g0481100_circ_g.7 Os05g0481100_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0481100-04:2 Os05t0481100-06:2 Os05t0481100-01:2 Os05t0481100-05:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.455539296 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23661552-23661155(+) 23661170-23661560(-) 23661175-23661481(-) |
| Potential amino acid sequence |
MKPIEHGKNIVREESPNHLSVLV*(+) MCSLKPKPRGGLDFPLSLCFYHAQ*(-) MQCAASNQNREVVWTFLSHYVFTMLNRLHPGQQFKKNNPKAVHITFIRQFMS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |