Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0750800_circ_g.4 |
ID in PlantcircBase | osa_circ_021927 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30938049-30942073 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0750800 |
Parent gene annotation |
Similar to Transcriptional adaptor (Fragment). (Os03t0750800-01) ;Similar to cDNA clone:J023128E10, full insert sequence. (Os03t0 750800-02);Similar to cDNA clone:J023128E10, full insert sequenc e. (Os03t0750800-03) |
Parent gene strand | - |
Alternative splicing | Os03g0750800_circ_g.1 Os03g0750800_circ_g.2 Os03g0750800_circ_g.3 Os03g0750800_circ_g.5 Os03g0750800_circ_g.6 Os03g0750800_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0750800-01:7 Os03t0750800-03:6 Os03t0750800-02:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104680824 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30941854-30938112(+) 30941922-30942012(-) |
Potential amino acid sequence |
MHCALVLVPTCSATSAQFPRPYISIPSRRRISSSAFQSGQIRGKDRLSLTSKYAIPLASVHDQF PNQFL*(+) MYGLGNWAEVAEHVGTKTKAQCIDHYTTAYMNSPCYPLPDMSHVNGKNRKELLAMAKVQGESKK VLPGDLTPKDESPFSPPRVKVEDALGEGLAGRSPSHIAGGANKKASNVGQFKDGANVAKVEDGH VDRSIGVKKPRYSADEGPSLTELSGYNSKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLR VLRIYLSRTTCLSLLFVQIGMQTRKSFF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |