Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0750800_circ_g.4 |
| ID in PlantcircBase | osa_circ_021927 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30938049-30942073 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0750800 |
| Parent gene annotation |
Similar to Transcriptional adaptor (Fragment). (Os03t0750800-01) ;Similar to cDNA clone:J023128E10, full insert sequence. (Os03t0 750800-02);Similar to cDNA clone:J023128E10, full insert sequenc e. (Os03t0750800-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0750800_circ_g.1 Os03g0750800_circ_g.2 Os03g0750800_circ_g.3 Os03g0750800_circ_g.5 Os03g0750800_circ_g.6 Os03g0750800_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0750800-01:7 Os03t0750800-03:6 Os03t0750800-02:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104680824 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30941854-30938112(+) 30941922-30942012(-) |
| Potential amino acid sequence |
MHCALVLVPTCSATSAQFPRPYISIPSRRRISSSAFQSGQIRGKDRLSLTSKYAIPLASVHDQF PNQFL*(+) MYGLGNWAEVAEHVGTKTKAQCIDHYTTAYMNSPCYPLPDMSHVNGKNRKELLAMAKVQGESKK VLPGDLTPKDESPFSPPRVKVEDALGEGLAGRSPSHIAGGANKKASNVGQFKDGANVAKVEDGH VDRSIGVKKPRYSADEGPSLTELSGYNSKRHEFDPEYDNDAEQALAEMEFKETDSETDRELKLR VLRIYLSRTTCLSLLFVQIGMQTRKSFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |