Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0750800_circ_g.7 |
| ID in PlantcircBase | osa_circ_021930 |
| Alias | Os_ciR3861 |
| Organism | Oryza sativa |
| Position | chr3: 30938751-30939142 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os03g0750800 |
| Parent gene annotation |
Similar to Transcriptional adaptor (Fragment). (Os03t0750800-01) ;Similar to cDNA clone:J023128E10, full insert sequence. (Os03t0 750800-02);Similar to cDNA clone:J023128E10, full insert sequenc e. (Os03t0750800-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0750800_circ_g.1 Os03g0750800_circ_g.2 Os03g0750800_circ_g.3 Os03g0750800_circ_g.4 Os03g0750800_circ_g.5 Os03g0750800_circ_g.6 |
| Support reads | 2/2 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0750800-01:3 Os03t0750800-02:3 Os03t0750800-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.304341093 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30938945-30939139(+) |
| Potential amino acid sequence |
MCEGDRPAKPSPSASSTLTLGGENGDSSLGVKSPGNTEVPSTFATLAPSLNCPTFDAFLFAPPA MCEGDRPAKPSPSASSTLTLGGENGDSSLGVKSPGNTEVPSTFATLAPSLNCPTFDAFLFAPPA MCEGDRPAKPSPSASSTLTLGGENGDSSLGVKSPGNTEVPSTFATLAPSLNCPTFDAFLFAPPA MCEGDRPAKPSPSASSTLTLGGENGDSSLGVKSPGNTEV(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |