Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0258900_circ_g.13 |
ID in PlantcircBase | osa_circ_030457 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 8309712-8310219 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0258900 |
Parent gene annotation |
NAD(P)-binding domain containing protein. (Os06t0258900-01);Simi lar to predicted protein. (Os06t0258900-02) |
Parent gene strand | + |
Alternative splicing | Os06g0258900_circ_g.4 Os06g0258900_circ_g.5 Os06g0258900_circ_g.6 Os06g0258900_circ_g.7 Os06g0258900_circ_g.8 Os06g0258900_circ_g.9 Os06g0258900_circ_g.10 Os06g0258900_circ_g.11 Os06g0258900_circ_g.12 Os06g0258900_circ_g.14 Os06g0258900_circ_g.15 Os06g0258900_circ_g.16 Os06g0258900_circ_g.17 Os06g0258900_circ_g.18 Os06g0258900_circ_g.19 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0258900-01:3 Os06t0258900-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006645* |
PMCS | 0.315514829 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8309948-8310216(+) |
Potential amino acid sequence |
MDAWIICPFFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKSSNLRQATLLVKDICRN LEAAAKSVPGVSYTVVLRGDSTLRGHFPEEADAVVSVLGEMDAWIICPFFLQGGRYTIDDIHYV ADSDRLIPAGETEFAKDAAFGYKSSNLRQATLLVKDICRNLEAAAKSVPGVSYTVVLRGDSTLR GHFPEEADAVVSVLGEMDAWIICPFFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKS SNLRQATLLVKDICRNLEAAAKSVPGVSYTVVLRGDSTLRGHFPEEADAVVSVLGEMDAWIICP FFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKSSNLRQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |