Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0258900_circ_g.13 |
| ID in PlantcircBase | osa_circ_030457 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 8309712-8310219 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0258900 |
| Parent gene annotation |
NAD(P)-binding domain containing protein. (Os06t0258900-01);Simi lar to predicted protein. (Os06t0258900-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0258900_circ_g.4 Os06g0258900_circ_g.5 Os06g0258900_circ_g.6 Os06g0258900_circ_g.7 Os06g0258900_circ_g.8 Os06g0258900_circ_g.9 Os06g0258900_circ_g.10 Os06g0258900_circ_g.11 Os06g0258900_circ_g.12 Os06g0258900_circ_g.14 Os06g0258900_circ_g.15 Os06g0258900_circ_g.16 Os06g0258900_circ_g.17 Os06g0258900_circ_g.18 Os06g0258900_circ_g.19 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0258900-01:3 Os06t0258900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006645* |
| PMCS | 0.315514829 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8309948-8310216(+) |
| Potential amino acid sequence |
MDAWIICPFFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKSSNLRQATLLVKDICRN LEAAAKSVPGVSYTVVLRGDSTLRGHFPEEADAVVSVLGEMDAWIICPFFLQGGRYTIDDIHYV ADSDRLIPAGETEFAKDAAFGYKSSNLRQATLLVKDICRNLEAAAKSVPGVSYTVVLRGDSTLR GHFPEEADAVVSVLGEMDAWIICPFFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKS SNLRQATLLVKDICRNLEAAAKSVPGVSYTVVLRGDSTLRGHFPEEADAVVSVLGEMDAWIICP FFLQGGRYTIDDIHYVADSDRLIPAGETEFAKDAAFGYKSSNLRQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |