Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0600700_circ_g.1 |
| ID in PlantcircBase | osa_circ_009747 |
| Alias | Os_ciR7126 |
| Organism | Oryza sativa |
| Position | chr11: 23066681-23068972 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0600700 |
| Parent gene annotation |
Similar to RING domain protein. (Os11t0600700-01);Similar to RIN G domain protein. (Os11t0600700-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0600700_circ_g.2 Os11g0600700_circ_g.3 Os11g0600700_circ_g.4 Os11g0600700_circ_g.5 Os11g0600700_circ_g.6 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0600700-02:2 Os11t0600700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.115513024 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23068903-23066702(+) 23066732-23066710(+) 23066935-23068952(-) |
| Potential amino acid sequence |
MLIELVCNAGAMRKETLHVKSVMRNLILLGN*(+) MGDHVVVNVEGLGNDGGAVEKPSEAVNSSVVAAASLSTTVDTVEEGGGEEEPLIQAAECRICQE EDSIKNLEKPCACSGSLKYAHRACVQRWCNEKGDITCEICHEEFDSPGELTC*(+) MLSSSWHIRHSAAWMSGSSSPPPSSTVSTVVESDAAATTELFTASDGFSTAPPSFPKPSTFTTT WSPIPNSFSPNKLIPQENQIPHDRFHM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |