Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d053308_circ_g.4 |
ID in PlantcircBase | zma_circ_008270 |
Alias | Zm04circ00103, GRMZM5G854613_C3 |
Organism | Zea mays |
Position | chr4: 225418049-225418792 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d053308 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Zm00001d053308_circ_g.1 Zm00001d053308_circ_g.2 Zm00001d053308_circ_g.3 Zm00001d053308_circ_g.5 Zm00001d053308_circ_g.6 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d053308_T004:3 Zm00001d053308_T007:3 Zm00001d053308_T009:3 Zm00001d053308_T006:3 Zm00001d053308_T002:3 Zm00001d053308_T008:3 Zm00001d053308_T001:3 Zm00001d053308_T005:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.223305593 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
225418722-225418782(-) |
Potential amino acid sequence |
MGSGIATSLLVSNISVVLKEVNPQFLQRGEKTIAGNLEGLVKRGSLTKDRMHKAMALLKGALDY SDFKDVDMVIEAVIEKIPLKQSIFADIEKICPKHCILATNTSTIDLNVVGKKTNSQDRIIGAHF FRCQV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |