Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d053308_circ_g.4 |
| ID in PlantcircBase | zma_circ_008270 |
| Alias | Zm04circ00103, GRMZM5G854613_C3 |
| Organism | Zea mays |
| Position | chr4: 225418049-225418792 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d053308 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Zm00001d053308_circ_g.1 Zm00001d053308_circ_g.2 Zm00001d053308_circ_g.3 Zm00001d053308_circ_g.5 Zm00001d053308_circ_g.6 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d053308_T004:3 Zm00001d053308_T007:3 Zm00001d053308_T009:3 Zm00001d053308_T006:3 Zm00001d053308_T002:3 Zm00001d053308_T008:3 Zm00001d053308_T001:3 Zm00001d053308_T005:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223305593 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
225418722-225418782(-) |
| Potential amino acid sequence |
MGSGIATSLLVSNISVVLKEVNPQFLQRGEKTIAGNLEGLVKRGSLTKDRMHKAMALLKGALDY SDFKDVDMVIEAVIEKIPLKQSIFADIEKICPKHCILATNTSTIDLNVVGKKTNSQDRIIGAHF FRCQV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |