Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0701200_circ_g.1 |
| ID in PlantcircBase | osa_circ_032207 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 29511071-29512643 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0701200 |
| Parent gene annotation |
UTP--glucose-1-phosphate uridylyltransferase family protein. (Os 06t0701200-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0701200_circ_g.2 Os06g0701200_circ_g.3 Os06g0701200_circ_g.4 Os06g0701200_circ_g.5 Os06g0701200_circ_g.6 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0701200-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.148299899 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29512621-29511466(+) 29512613-29512642(-) |
| Potential amino acid sequence |
MGSLYCIHLGFTNSEMAPCVFWSSSIYGPISSINWFIFPGYGEYPVSQFASPSGCPVARRSGSS *(+) MTSDDTNALTVKLLESNSYFGMEPSQVHILKQEKVACLADNDARLALDPNDKYKIQTKPHGHGD VHALLYSSGLLEQWKSTGRKWVLFFQDTNGLLFNAIPSALGVSATKGYNVNSLAVPRKAKEAIG GITKLTHVDGRTMVINVEYNQLDPLLRATGHPDGDANCETGYSPYPGNINQLILEIGPYMEELQ KTHGAISEFVNPK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |