Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0701200_circ_g.1 |
ID in PlantcircBase | osa_circ_032207 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 29511071-29512643 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0701200 |
Parent gene annotation |
UTP--glucose-1-phosphate uridylyltransferase family protein. (Os 06t0701200-01) |
Parent gene strand | - |
Alternative splicing | Os06g0701200_circ_g.2 Os06g0701200_circ_g.3 Os06g0701200_circ_g.4 Os06g0701200_circ_g.5 Os06g0701200_circ_g.6 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0701200-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.148299899 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29512621-29511466(+) 29512613-29512642(-) |
Potential amino acid sequence |
MGSLYCIHLGFTNSEMAPCVFWSSSIYGPISSINWFIFPGYGEYPVSQFASPSGCPVARRSGSS *(+) MTSDDTNALTVKLLESNSYFGMEPSQVHILKQEKVACLADNDARLALDPNDKYKIQTKPHGHGD VHALLYSSGLLEQWKSTGRKWVLFFQDTNGLLFNAIPSALGVSATKGYNVNSLAVPRKAKEAIG GITKLTHVDGRTMVINVEYNQLDPLLRATGHPDGDANCETGYSPYPGNINQLILEIGPYMEELQ KTHGAISEFVNPK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |