Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0701200_circ_g.4 |
| ID in PlantcircBase | osa_circ_032210 |
| Alias | Os06circ17593 |
| Organism | Oryza sativa |
| Position | chr6: 29511376-29512643 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os06g0701200 |
| Parent gene annotation |
UTP--glucose-1-phosphate uridylyltransferase family protein. (Os 06t0701200-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0701200_circ_g.1 Os06g0701200_circ_g.2 Os06g0701200_circ_g.3 Os06g0701200_circ_g.5 Os06g0701200_circ_g.6 |
| Support reads | 2/1 |
| Tissues | leaf and panicle/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0701200-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006930* |
| PMCS | 0.373467284 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29512621-29511809(+) 29512613-29512610(-) |
| Potential amino acid sequence |
MGSLYCIHLVYISRVWRVPCFTICISIRMSGCTKEWIKLIVLDIDDHCSTIDMSKFCYSSNGFF CLPWNCKRINIITFGGADT*(+) MTSDDTNALTVKLLESNSYFGMEPSQVHILKQEKVACLADNDARLALDPNDKYKIQTKPHGHGD VHALLYSSGLLEQWKSTGRKWVLFFQDTNGLLFNAIPSALGVSATKGYNVNSLAVPRKAKEAIG GITKLTHVDGRTMVINVEYNQLDPLLRATGHPDGDANCETGYSPYPGNINQVNAIQRSHLLL*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |