Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0512800_circ_g.3 |
ID in PlantcircBase | osa_circ_007654 |
Alias | Os_ciR6846 |
Organism | Oryza sativa |
Position | chr10: 19761134-19761313 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os10g0512800 |
Parent gene annotation |
Similar to predicted protein. (Os10t0512800-01) |
Parent gene strand | - |
Alternative splicing | Os10g0512800_circ_g.1 Os10g0512800_circ_g.2 Os10g0512800_circ_g.4 Os10g0512800_circ_g.5 Os10g0512800_circ_g.6 Os10g0512800_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0512800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.464431852 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19761294-19761136(-) |
Potential amino acid sequence |
MQSRLEEEEEAKAALMSRIQRLTKLILVSTKNNIPALTDTSSHQRHNSVNEEDLEEGQVKMQSR LEEEEEAKAALMSRIQRLTKLILVSTKNNIPALTDTSSHQRHNSVNEEDLEEGQVKMQSRLEEE EEAKAALMSRIQRLTKLILVSTKNNIPALTDTSSHQRHNSVNEEDLEEGQVKMQSRLEEEEEAK AALMSRIQRLTKLILVSTKNNIPALTDTSSHQRHNSVNEED(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |