Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0512800_circ_g.7 |
ID in PlantcircBase | osa_circ_007658 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 19761932-19762837 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0512800 |
Parent gene annotation |
Similar to predicted protein. (Os10t0512800-01) |
Parent gene strand | - |
Alternative splicing | Os10g0512800_circ_g.1 Os10g0512800_circ_g.2 Os10g0512800_circ_g.3 Os10g0512800_circ_g.4 Os10g0512800_circ_g.5 Os10g0512800_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0512800-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.180509566 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19762828-19762596(+) 19762618-19762771(-) |
Potential amino acid sequence |
MPMLETWPWPLNDDCSRRVNLESRYGICVALPSLSFPITVPRVKRLLLMYDPSLLLSPVVSVLE LSDPARSIKLSCEYMTPSYSSP*(+) MIESSAHGDEYDGVMYSQLNLIDLAGSESSKTETTGLRRREGSYINKSLLTLGTVIGKLSEGRA THIPYRDSKLTRLLQSSLSGHGHVSSIGMLVQTTSTYLAAEVIPFSH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |