Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0342400_circ_g.4 |
ID in PlantcircBase | osa_circ_036794 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 15445479-15446600 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0342400 |
Parent gene annotation |
Similar to aspartate kinase-homoserine dehydrogenase. (Os08t0342 400-01);Similar to Bifunctional aspartokinase/homoserine dehydro genase 1, chloroplast precursor (AK-HD 1) (AK-HSDH 1) [Includes: Aspartokinase (EC 2.7.2.4); Homoserine dehydrogenase (EC 1.1.1. 3)]. (Os08t0342400-02);Similar to Bifunctional aspartokinase/hom oserine dehydrogenase 1, chloroplast precursor (AK-HD 1) (AK-HSD H 1) [Includes: Aspartokinase (EC 2.7.2.4); Homoserine dehydroge nase (EC 1.1.1.3)]. (Os08t0342400-03) |
Parent gene strand | - |
Alternative splicing | Os08g0342400_circ_g.1 Os08g0342400_circ_g.2 Os08g0342400_circ_g.3 Os08g0342400_circ_g.5 Os08g0342400_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0342400-03:4 Os08t0342400-01:4 Os08t0342400-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.172910361 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15446552-15446582(-) |
Potential amino acid sequence |
MSYFGANVLHPRTIIPVMKYNIPIVIRNMFNISAPGTMICQQPANESGDLEACVKAFATIDKLS LVNVEGTGMAGVPGTASAIFGAVKDVGANVIMISQASSEHSVCFAVPEKEVAAVSAALHVRFRE ALSAGRLSKLARLSY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |