Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d050116_circ_g.3 |
| ID in PlantcircBase | zma_circ_008041 |
| Alias | Zm04circ00033, zma_circ_0001421, GRMZM5G838910_C1 |
| Organism | Zea mays |
| Position | chr4: 66982766-66984001 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d050116 |
| Parent gene annotation |
Protein EMSY-LIKE 4 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d050116_circ_g.1 Zm00001d050116_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d050116_T001:4 Zm00001d050116_T003:5 Zm00001d050116_T002:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_036749* osi_circ_007674* osi_circ_017796 |
| PMCS | 0.110542129 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
66982811-66982810(+) 66982794-66983856(-) |
| Potential amino acid sequence |
MKGSGRITGNGRDSVGASLYTRVQPQTDMETQIHELEQEAYCSVLRAFKAQSDAITWEKESLIT ELRKELQVSDKEHRELLNKVNGDDIIRRIRKWRESTGGLMINLVNNSQRTHDPIPSPTTSARKR QKMSQPILSACVPAPSAMHSQPLTAPMQPSSSGAKKGAQPGTKVKKTKPGQKIPGGSAVKSMPS SAGPGGRGTIINRNMSAGLPPESSQLNPLIGRKVMTRWPDDNSFYEAEITDYDASKDIYTLVYD INTADETWEWVDFKEEPMMIFHNHIRTAEA*(+) MIVEDHHRFLLEVNPFPCLVCCIYVINQCIDIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |