Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050116_circ_g.3 |
ID in PlantcircBase | zma_circ_008041 |
Alias | Zm04circ00033, zma_circ_0001421, GRMZM5G838910_C1 |
Organism | Zea mays |
Position | chr4: 66982766-66984001 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d050116 |
Parent gene annotation |
Protein EMSY-LIKE 4 |
Parent gene strand | + |
Alternative splicing | Zm00001d050116_circ_g.1 Zm00001d050116_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d050116_T001:4 Zm00001d050116_T003:5 Zm00001d050116_T002:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_036749* osi_circ_007674* osi_circ_017796 |
PMCS | 0.110542129 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
66982811-66982810(+) 66982794-66983856(-) |
Potential amino acid sequence |
MKGSGRITGNGRDSVGASLYTRVQPQTDMETQIHELEQEAYCSVLRAFKAQSDAITWEKESLIT ELRKELQVSDKEHRELLNKVNGDDIIRRIRKWRESTGGLMINLVNNSQRTHDPIPSPTTSARKR QKMSQPILSACVPAPSAMHSQPLTAPMQPSSSGAKKGAQPGTKVKKTKPGQKIPGGSAVKSMPS SAGPGGRGTIINRNMSAGLPPESSQLNPLIGRKVMTRWPDDNSFYEAEITDYDASKDIYTLVYD INTADETWEWVDFKEEPMMIFHNHIRTAEA*(+) MIVEDHHRFLLEVNPFPCLVCCIYVINQCIDIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |