Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0817300_circ_g.3 |
ID in PlantcircBase | osa_circ_017187 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35058545-35058808 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0817200 |
Parent gene annotation |
WD-40 repeat containing protein. (Os02t0817200-01);Similar to ac tin-related protein 2/3 complex subunit 1B. (Os02t0817200-02) |
Parent gene strand | - |
Alternative splicing | Os02g0817300_circ_g.4 Os02g0817300_circ_g.5 Os02g0817300_circ_g.6 Os02g0817300_circ_g.7 Os02g0817300_circ_g.8 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0817300-00:2 Os02t0817300-00:2 Os02t0817200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.572010922 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35058797-35058746(+) 35058562-35058783(-) 35058799-35058783(-) |
Potential amino acid sequence |
MELCPKSSLICRKDHRIAIKSNTNHRPFRKKKNITERQITQC*(+) MRLDFGHNSMIYFIDDVETSPAAQNLALRDLPLRDILFLSERTVIGVGFDCNPMIFSADETGLW AQFHDLFH*(-) MIYFIDDVETSPAAQNLALRDLPLRDILFLSERTVIGVGFDCNPMIFSADETGLWAQFHDLFH* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |