Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0749800_circ_g.5 |
| ID in PlantcircBase | osa_circ_021919 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30892285-30892999 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0749800 |
| Parent gene annotation |
Similar to Tousled-like protein kinase. (Os03t0749800-01);Simila r to Tousled-like kinase (Fragment). (Os03t0749800-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0749800_circ_g.1 Os03g0749800_circ_g.2 Os03g0749800_circ_g.3 Os03g0749800_circ_g.4 Os03g0749800_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0749800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.31917169 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30892937-30892295(+) 30892771-30892936(-) |
| Potential amino acid sequence |
MILASFSGRIGVALRTASRSLPSMR*(+) MELTSQGAGTYWYLPPECFDLSKTPFISSKAKILMQSLKQHRFFQKRKRES*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |