Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0749800_circ_g.5 |
ID in PlantcircBase | osa_circ_021919 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30892285-30892999 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0749800 |
Parent gene annotation |
Similar to Tousled-like protein kinase. (Os03t0749800-01);Simila r to Tousled-like kinase (Fragment). (Os03t0749800-02) |
Parent gene strand | - |
Alternative splicing | Os03g0749800_circ_g.1 Os03g0749800_circ_g.2 Os03g0749800_circ_g.3 Os03g0749800_circ_g.4 Os03g0749800_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0749800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.31917169 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30892937-30892295(+) 30892771-30892936(-) |
Potential amino acid sequence |
MILASFSGRIGVALRTASRSLPSMR*(+) MELTSQGAGTYWYLPPECFDLSKTPFISSKAKILMQSLKQHRFFQKRKRES*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |