Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0834200_circ_g.5 |
| ID in PlantcircBase | osa_circ_004723 |
| Alias | Os_ciR6241 |
| Organism | Oryza sativa |
| Position | chr1: 35736580-35737484 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0834200 |
| Parent gene annotation |
Similar to T-cell immune regulator 1 transcript variant 3 (Fragm ent). (Os01t0834200-01);Similar to VHA-A1 (VACUOLAR PROTON ATPAS E A 1); ATPase. (Os01t0834200-02);Similar to T-cell immune regul ator 1 transcript variant 3 (Fragment). (Os01t0834200-03);Simila r to VHA-A1 (VACUOLAR PROTON ATPASE A 1); ATPase. (Os01t0834200- 04) |
| Parent gene strand | + |
| Alternative splicing | Os01g0834200_circ_g.2 Os01g0834200_circ_g.3 Os01g0834200_circ_g.4 Os01g0834200_circ_g.6 Os01g0834200_circ_g.7 Os01g0834200_circ_g.8 Os01g0834200_circ_g.9 Os01g0834200_circ_g.10 Os01g0834200_circ_g.11 |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0834200-01:4 Os01t0834200-02:4 Os01t0834200-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010898 |
| PMCS | 0.401404687 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35736689-35736580(+) |
| Potential amino acid sequence |
MVKQRQIFREVSGRLADLEATLDAGIQHRNKALESVGSQLWRWTIMVKKEKAVYDTLNMLNFDV TKKCLVGEGWCPIFAKSQIKDVLQRATLHSNSQVGIIFHEMDTIDSPPTYFQTDKFTNAFQEIV DAYG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |