Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA014534_circ_g.2 |
| ID in PlantcircBase | osi_circ_005666 |
| Alias | 4:27266588|27267031 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 27266588-27267031 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA014534 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA014534_circ_g.5 BGIOSGA014534_circ_igg.1 BGIOSGA014534_circ_g.3 BGIOSGA014534_circ_igg.4 BGIOSGA014534_circ_g.5 BGIOSGA014534_circ_g.6 BGIOSGA014534_circ_g.7 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA014534-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_024919* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27266985-27266997(-) 27266650-27267017(-) |
| Potential amino acid sequence |
MFELVTLYRYSHLGGRLPAYDGRKSLYTAGPLPFASRTFEITLQDEEDSLGGGQGTQRRERLFR VVIKFAARADLHHLAMFLAGRQADAPQEALQVLDIVLRELPTTRYLLLLRLLHVA*(-) MLLKKPFKSLTLCYVNCLPQGIYYS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |