Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA014534_circ_g.2 |
ID in PlantcircBase | osi_circ_005666 |
Alias | 4:27266588|27267031 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 27266588-27267031 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA014534 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA014534_circ_g.5 BGIOSGA014534_circ_igg.1 BGIOSGA014534_circ_g.3 BGIOSGA014534_circ_igg.4 BGIOSGA014534_circ_g.5 BGIOSGA014534_circ_g.6 BGIOSGA014534_circ_g.7 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA014534-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_024919* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27266985-27266997(-) 27266650-27267017(-) |
Potential amino acid sequence |
MFELVTLYRYSHLGGRLPAYDGRKSLYTAGPLPFASRTFEITLQDEEDSLGGGQGTQRRERLFR VVIKFAARADLHHLAMFLAGRQADAPQEALQVLDIVLRELPTTRYLLLLRLLHVA*(-) MLLKKPFKSLTLCYVNCLPQGIYYS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |