Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0157800_circ_g.2 |
| ID in PlantcircBase | osa_circ_018024 |
| Alias | Os_ciR2181 |
| Organism | Oryza sativa |
| Position | chr3: 3107100-3108391 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0157800 |
| Parent gene annotation |
Hypothetical conserved gene. (Os03t0157800-01);Helicase and RNas e D C-terminal, HRDC domain containing protein. (Os03t0157800-02 );Non-protein coding transcript. (Os03t0157800-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0157800_circ_g.1 Os03g0157800_circ_g.3 Os03g0157800_circ_g.4 Os03g0157800_circ_g.5 |
| Support reads | 6/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0157800-02:5 Os03t0157800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004555* osi_circ_013689 |
| PMCS | 0.351527761 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3107135-3107105(+) |
| Potential amino acid sequence |
MYDLMRLRLQKESTSDNDLLLEVQKRSNEICLQLYEKELLTDTSYLHIYGLQEHDLDAKQLAVV YALHQWRDYIAREVDESTGYVLPNKALIEIAKKMPTDTAELKRMVKSKYPFVDENLDQVVGIIW NATESSYAFESRAEQLKKERLEQVC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |