Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0157800_circ_g.2 |
ID in PlantcircBase | osa_circ_018024 |
Alias | Os_ciR2181 |
Organism | Oryza sativa |
Position | chr3: 3107100-3108391 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0157800 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0157800-01);Helicase and RNas e D C-terminal, HRDC domain containing protein. (Os03t0157800-02 );Non-protein coding transcript. (Os03t0157800-03) |
Parent gene strand | + |
Alternative splicing | Os03g0157800_circ_g.1 Os03g0157800_circ_g.3 Os03g0157800_circ_g.4 Os03g0157800_circ_g.5 |
Support reads | 6/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0157800-02:5 Os03t0157800-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004555* osi_circ_013689 |
PMCS | 0.351527761 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3107135-3107105(+) |
Potential amino acid sequence |
MYDLMRLRLQKESTSDNDLLLEVQKRSNEICLQLYEKELLTDTSYLHIYGLQEHDLDAKQLAVV YALHQWRDYIAREVDESTGYVLPNKALIEIAKKMPTDTAELKRMVKSKYPFVDENLDQVVGIIW NATESSYAFESRAEQLKKERLEQVC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |