Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0286400_circ_g.10 |
ID in PlantcircBase | osa_circ_038740 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 6378878-6379067 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0286400 |
Parent gene annotation |
Sodium/hydrogen exchanger subfamily protein. (Os09t0286400-01) |
Parent gene strand | - |
Alternative splicing | Os09g0286400_circ_g.4 Os09g0286400_circ_g.5 Os09g0286400_circ_g.6 Os09g0286400_circ_g.7 Os09g0286400_circ_g.8 Os09g0286400_circ_g.9 Os09g0286400_circ_g.11 Os09g0286400_circ_g.12 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0286400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.2252625 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6378966-6378951(+) 6379069-6378906(-) |
Potential amino acid sequence |
MTLSCKAKSPSDDNEPTKVSRNWKTIIKKFSPAAA*(+) MAISLYRTMSLVRSQAAAGENFFMMVFQFLETFVGSLSSDGDFALQDNVIGQKSSSSWGELLYD GFPVP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |