Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0286400_circ_g.11 |
| ID in PlantcircBase | osa_circ_038741 |
| Alias | Os09circ02046/Os_ciR12009 |
| Organism | Oryza sativa |
| Position | chr9: 6380709-6381481 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os09g0286400 |
| Parent gene annotation |
Sodium/hydrogen exchanger subfamily protein. (Os09t0286400-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0286400_circ_g.4 Os09g0286400_circ_g.5 Os09g0286400_circ_g.6 Os09g0286400_circ_g.7 Os09g0286400_circ_g.8 Os09g0286400_circ_g.9 Os09g0286400_circ_g.10 Os09g0286400_circ_g.12 |
| Support reads | 3/2/1 |
| Tissues | panicle/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0286400-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007993* osi_circ_018880 |
| PMCS | 0.297638131 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6380927-6380728(+) 6381241-6381478(-) |
| Potential amino acid sequence |
MNVPRMAKVTIAPKFAKNGFGDRLNPDWNIIGGNKNKKKNSSWKLNHILVLVSVFEILASPPTT RPGILITQ*(+) MWFNFHDEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLVYLGGLTF LMYKLPFVECLMFGALISATDPVTVLSIFQV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |