Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0286400_circ_g.11 |
ID in PlantcircBase | osa_circ_038741 |
Alias | Os09circ02046/Os_ciR12009 |
Organism | Oryza sativa |
Position | chr9: 6380709-6381481 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os09g0286400 |
Parent gene annotation |
Sodium/hydrogen exchanger subfamily protein. (Os09t0286400-01) |
Parent gene strand | - |
Alternative splicing | Os09g0286400_circ_g.4 Os09g0286400_circ_g.5 Os09g0286400_circ_g.6 Os09g0286400_circ_g.7 Os09g0286400_circ_g.8 Os09g0286400_circ_g.9 Os09g0286400_circ_g.10 Os09g0286400_circ_g.12 |
Support reads | 3/2/1 |
Tissues | panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0286400-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007993* osi_circ_018880 |
PMCS | 0.297638131 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6380927-6380728(+) 6381241-6381478(-) |
Potential amino acid sequence |
MNVPRMAKVTIAPKFAKNGFGDRLNPDWNIIGGNKNKKKNSSWKLNHILVLVSVFEILASPPTT RPGILITQ*(+) MWFNFHDEFFFLFLLPPIIFQSGFSLSPKPFFANFGAIVTFAILGTFIASVVTGVLVYLGGLTF LMYKLPFVECLMFGALISATDPVTVLSIFQV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |