Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0545000_circ_g.7 |
| ID in PlantcircBase | osa_circ_009545 |
| Alias | Os11circ06816/Os_ciR882 |
| Organism | Oryza sativa |
| Position | chr11: 20047712-20047966 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os11g0545000 |
| Parent gene annotation |
NOP5, N-terminal domain containing protein. (Os11t0545000-01);Co nserved hypothetical protein. (Os11t0545000-02);NOP5, N-terminal domain containing protein. (Os11t0545000-03) |
| Parent gene strand | - |
| Alternative splicing | Os11g0544900_circ_ag.1 Os11g0545000_circ_g.1 Os11g0545000_circ_g.2 Os11g0545000_circ_g.3 Os11g0545000_circ_g.4 Os11g0545000_circ_g.5 Os11g0545000_circ_g.6 |
| Support reads | 5/31/6/17 |
| Tissues | leaf/root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0545000-03:2 Os11t0545000-02:1 Os11t0545000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009095 |
| PMCS | 0.417398039 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20047944-20047920(-) |
| Potential amino acid sequence |
MACTCCCLRHPLASQFSLFVGSTSTYQMRYKIFGRCSVLTGLHMTCCGLCEESWLVLAAA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |