Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0545000_circ_g.7 |
ID in PlantcircBase | osa_circ_009545 |
Alias | Os11circ06816/Os_ciR882 |
Organism | Oryza sativa |
Position | chr11: 20047712-20047966 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os11g0545000 |
Parent gene annotation |
NOP5, N-terminal domain containing protein. (Os11t0545000-01);Co nserved hypothetical protein. (Os11t0545000-02);NOP5, N-terminal domain containing protein. (Os11t0545000-03) |
Parent gene strand | - |
Alternative splicing | Os11g0544900_circ_ag.1 Os11g0545000_circ_g.1 Os11g0545000_circ_g.2 Os11g0545000_circ_g.3 Os11g0545000_circ_g.4 Os11g0545000_circ_g.5 Os11g0545000_circ_g.6 |
Support reads | 5/31/6/17 |
Tissues | leaf/root/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0545000-03:2 Os11t0545000-02:1 Os11t0545000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009095 |
PMCS | 0.417398039 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20047944-20047920(-) |
Potential amino acid sequence |
MACTCCCLRHPLASQFSLFVGSTSTYQMRYKIFGRCSVLTGLHMTCCGLCEESWLVLAAA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |