Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0545000_circ_g.6 |
ID in PlantcircBase | osa_circ_009544 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 20046684-20047966 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0545000 |
Parent gene annotation |
NOP5, N-terminal domain containing protein. (Os11t0545000-01);Co nserved hypothetical protein. (Os11t0545000-02);NOP5, N-terminal domain containing protein. (Os11t0545000-03) |
Parent gene strand | - |
Alternative splicing | Os11g0544900_circ_ag.1 Os11g0545000_circ_g.1 Os11g0545000_circ_g.2 Os11g0545000_circ_g.3 Os11g0545000_circ_g.4 Os11g0545000_circ_g.5 Os11g0545000_circ_g.7 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0545000-01:3 Os11t0545000-02:1 Os11t0545000-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.123080891 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20047942-20046828(+) 20047743-20047951(-) |
Potential amino acid sequence |
MILHKVHSTKVFSMIDLYSGFPTTNFCLGRRHFMIISVSCLLTPVSTLMALDLSSNF*(+) MFGTYRSSHDVIWLKEFQKFDDKSSAINVDTGVNKQLTEMIMKWRRPRQKLVVGKPEYKSIIEN TLVLWTL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |