Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0262200_circ_g.3 |
ID in PlantcircBase | osa_circ_018975 |
Alias | Os_ciR3896 |
Organism | Oryza sativa |
Position | chr3: 8573783-8575239 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0262150 |
Parent gene annotation |
Hypothetical gene. (Os03t0262150-01) |
Parent gene strand | + |
Alternative splicing | Os03g0262200_circ_g.2 Os03g0262200_circ_g.4 Os03g0262200_circ_g.5 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0262200-00:5 Os03t0262150-01:5 Os03t0262200-00:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.34680693 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8573787-8573818(-) 8573825-8575208(-) |
Potential amino acid sequence |
MEDSKLYIFLELVTQGSLASLYQKYRLRDTHVSAYTRQILNGLTYLHERNIVHRDIKCANILVH ANGSVKLADFGLAKEITKFNVLKSCKGTVYWMAPEVVNPKTTYGPEADIWSLGCTVLEMLTRQL PYPGLEWTQALYRIGKGEPPAIPNCLSRDARDFISQCVKPNPQDRPSAAKLLEHPFVNRSMRSI RSMRTSSRSNSSVRGING*(-) MDRIEDGFRISVEWRTQNCTSSLN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |