Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0262200_circ_g.2 |
| ID in PlantcircBase | osa_circ_018974 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8573783-8574292 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0262150 |
| Parent gene annotation |
Hypothetical gene. (Os03t0262150-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0262200_circ_g.3 Os03g0262200_circ_g.4 Os03g0262200_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0262200-00:2 Os03t0262150-01:2 Os03t0262200-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014162 |
| PMCS | 0.426170882 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8573787-8573818(-) 8573825-8574228(-) |
| Potential amino acid sequence |
MVVNPKTTYGPEADIWSLGCTVLEMLTRQLPYPGLEWTQALYRIGKGEPPAIPNCLSRDARDFI SQCVKPNPQDRPSAAKLLEHPFVNRSMRSIRSMRTSSRSNSSVRGING*(-) MDRIEDGFRISVEWLSIPRQHMDLKLIYGVWAAQS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |