Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0523100_circ_g.4 |
ID in PlantcircBase | osa_circ_024610 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 26170781-26171931 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0523100 |
Parent gene annotation |
Similar to OSIGBa0153E02-OSIGBa0093I20.5 protein. (Os04t0523100- 01);Similar to OSIGBa0153E02-OSIGBa0093I20.5 protein. (Os04t0523 100-02) |
Parent gene strand | - |
Alternative splicing | Os04g0523100_circ_g.1 Os04g0523100_circ_g.2 Os04g0523100_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0523100-01:2 Os04t0523100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.11290383 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26171909-26170834(+) 26171911-26171922(-) |
Potential amino acid sequence |
MMPCSFPYLSFFHLSSSVMVFRLPPP*(+) MKYIKIAASLPSKTVRDVAMKCQWLGKRENSRRRKSEDHHTGRKMKERKIWK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |