Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0523100_circ_g.1 |
ID in PlantcircBase | osa_circ_024607 |
Alias | Os_ciR3026 |
Organism | Oryza sativa |
Position | chr4: 26169815-26170298 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0523100 |
Parent gene annotation |
Similar to OSIGBa0153E02-OSIGBa0093I20.5 protein. (Os04t0523100- 01);Similar to OSIGBa0153E02-OSIGBa0093I20.5 protein. (Os04t0523 100-02) |
Parent gene strand | - |
Alternative splicing | Os04g0523100_circ_g.2 Os04g0523100_circ_g.3 Os04g0523100_circ_g.4 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0523100-02:1 Os04t0523100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.115381543 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26170294-26169817(-) |
Potential amino acid sequence |
MAEPSLWGTNHPVQTDTRVPSFVSHNAIQNNQILTGATEIDRAMQQLLVQNDRLLDQIEANMLA CQAKMAEPSLWGTNHPVQTDTRVPSFVSHNAIQNNQILTGATEIDRAMQQLLVQNDRLLDQIEA NMLACQAKMAEPSLWGTNHPVQTDTRVPSFVSHNAIQNNQILTGATEIDRAMQQLLVQNDRLLD QIEANMLACQAKMAEPSLWGTNHPVQTDTRVPSFVSHNAIQNNQILTGATEIDRAMQQLLVQND RLLDQIEANMLACQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |